BEST

LSbio ▼Human PTGS2 / COX2 / COX-2 Protein (Recombinant His) (aa18-601) - LS-G21094

LSbio ▼Human PTGS2 / COX2 / COX-2 Protein (Recombinant His) (aa18-601) - LS-G21094

브랜드 LSbio
품명 Human PTGS2 / COX2 / COX-2 Protein (Recombinant His) (aa18-601) - LS-G21094
CAT. NO LS-G21094-1000 분류 Recombinant Protein
규격 1000 μg 재고 -
소비자가(₩) 2,615,000 CAS. NO
온도 -20℃ 위험물
수입발주일 매주 목요일 오후 5시
주의사항 Short term: -20°C, Long term: -80°C

 

LS-G21094
Recombinant Protein
PTGS2 / COX2 / COX-2
Human
70.9 kD
aa 18-601
ANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTP
EFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNA
IMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRA
LPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDP
QGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLN
HIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQA
EMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNR
VCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQH
LSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYHWHPLL
PDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIA
GRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFM
LKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEK
PRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFG
GEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTV
TINASSSRSGLDDINPTVLLKERS

 

E. coli
E. coli
His
Not Tested
Not Tested
Tris buffer, 50% glycerol.
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
For research use only.

 

 

 


Data sheet

 

 

 

물품 이상, 파손의 경우 제품 수령 후 24시간 내에 연락 주시기 바랍니다.
교환과 반품은 물품 수령 후 2주일 이내에 가능합니다. 단, 수입발주 품목은 교환/반품이 불가합니다.
자세한 사항에 대해서는 동인바이오텍 대표번호 (02-431-7375)로 연락 주시기 바랍니다.