BEST

LSbio ▼Human VTN / Vitronectin Protein (Recombinant) - LS-G131

LSbio ▼Human VTN / Vitronectin Protein (Recombinant) - LS-G131

브랜드 LSbio
품명 Human VTN / Vitronectin Protein (Recombinant) - LS-G131
CAT. NO LS-G131-500 분류
규격 500 μg 재고 -
소비자가(₩) 599,000 CAS. NO
온도 위험물
수입발주일 매주 목요일 오후 5시
주의사항
Type
 
Recombinant Protein
Target
 
VTN / Vitronectin
Species
 
Human
Predicted Molecular Weight
 
75 kDa
AA Sequence
 
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Expression System
 
HEK 293 Cells
Source Species
 
Human
Purification
 
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
 
Recombinant Human Vitronectin promotes attachment of hESC and iPSC in serum-free, feeder conditions at 5 µg/ml.
Endotoxin
 
Less than 0.1 ng/µg of protein (less than 1EU/µg).
Presentation
 
Sterile filtered, lyophilized from 20 mM sodium phosphate, pH 7.5
Reconstitution
 
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Storage
 
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Presentation
 
Sterile filtered, lyophilized from 20 mM sodium phosphate, pH 7.5
Restrictions
 
For research use only.

 

물품 이상, 파손의 경우 제품 수령 후 24시간 내에 연락 주시기 바랍니다.
교환과 반품은 물품 수령 후 2주일 이내에 가능합니다. 단, 수입발주 품목은 교환/반품이 불가합니다.
자세한 사항에 대해서는 동인바이오텍 대표번호 (02-431-7375)로 연락 주시기 바랍니다.